Arti Kata "laru" Menurut KBBI

Arti kata, ejaan, dan contoh penggunaan kata "laru" menurut Kamus Besar Bahasa Indonesia (KBBI).

la·ru Jw n 1 bibit atau biang kapang yg digunakan dl fermentasi; 2 benda (ragi) yg dicampurkan ke dl nira (cuka dsb) supaya rasanya berubah;
-- tempe laru yg mengandung Rhizopus orizal, yg dl pertumbuhannya mampu memecah susunan kimia protein yg kompleks menjadi sederhana dan mudah dicerna: setelah direbus dan setelah dingin, kacang kedele diberi campuran -- tempe dan dibungkus rapat;
me·la·ru v mencampur dng laru

Bantuan Penjelasan Simbol
a Adjektiva, Merupakan Bentuk Kata Sifat
v Verba, Merupakan Bentuk Kata Kerja
n Merupakan Bentuk Kata benda
ki Merupakan Bentuk Kata kiasan
pron kata yang meliputi kata ganti, kata tunjuk, atau kata tanya
cak Bentuk kata percakapan (tidak baku)
ark Arkais, Bentuk kata yang tidak lazim digunakan
adv Adverbia, kata yang menjelaskan verba, adjektiva, adverbia lain
-- Pengganti kata "laru"

Kata yang Mirip :


Sedang Dilihat

larunyonyapermisifmenstruasitalonbulirtowelrudalrealitasasta-kaluthomiliseduayahudejeritsuarjembutkamuflasecerdiksyahadankecimpringkridabegasicobakambing hitamberai-iresersekejutlangca

Komentar dan Tanggapan

Mohon melaporkan iklan yg membuat Anda tidak nyaman melalui link berikut: melaporkan iklan yg membuat Anda tidak nyaman melalui link berikut: