Arti Kata "antigen" Menurut KBBI

Arti kata, ejaan, dan contoh penggunaan kata "antigen" menurut Kamus Besar Bahasa Indonesia (KBBI).

an·ti·gen /antigén/ n Kim zat (msl protein atau toksin) yg dapat merangsang pembentukan antibodi jika diinjeksikan ke dl tubuh

Bantuan Penjelasan Simbol
a Adjektiva, Merupakan Bentuk Kata Sifat
v Verba, Merupakan Bentuk Kata Kerja
n Merupakan Bentuk Kata benda
ki Merupakan Bentuk Kata kiasan
pron kata yang meliputi kata ganti, kata tunjuk, atau kata tanya
cak Bentuk kata percakapan (tidak baku)
ark Arkais, Bentuk kata yang tidak lazim digunakan
adv Adverbia, kata yang menjelaskan verba, adjektiva, adverbia lain
-- Pengganti kata "antigen"

Sedang Dilihat

antigenmahakaryapedetrevitalisasisahanginsersigeluncurmangkakbadasiautotrofiksihWedakomfortabeltohyaumdepartementalrumorper -- anfraseologigelepaimangkinparihgelatinhaikmuralkrecektegarkalandermengapapanyembrama

Komentar dan Tanggapan

Mohon melaporkan iklan yg membuat Anda tidak nyaman melalui link berikut: melaporkan iklan yg membuat Anda tidak nyaman melalui link berikut: